ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.05.H01
Name
Dodecin
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.05
Name
Halobacterium salinarum
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Not known

Protein Classification

EC ID
E0
EC Number
-
Type
UNKNOWN FUNCTION

Optimum Physiochemical Conditions

Extreme-Stability ID
HA03
Optimum Condition
2.5-5.2M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
8378.0
Sequence Length
(amino acid numbers)
77
Sequence
MPAPAECCHMVFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELDGSQ

Protein Parameters

PID
H.P0030
Amino acid content (%)
 
Ala
12.987
Cys
2.597
Asp
9.091
Glu
12.987
Phe
3.896
Gly
5.195
His
1.299
Ile
2.597
Lys
2.597
Leu
5.195
Met
2.597
Asn
1.299
Pro
2.597
Gln
5.195
Arg
2.597
Ser
3.896
Thr
7.792
Val
12.987
Trp
1.299
Tyr
1.299
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
32.47
Small (A+C+D+G+N+P+S+T+V)
58.44
Aliphatic (A+I+L+V)
33.77
Aromatic (F+H+W+Y)
7.79
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
53.25
Polar (D+E+H+K+N+Q+R+S)
46.75
Charged (D+E+H+K+R)
28.57
Basic (H+K+R)
6.49
Acidic (D+E)
22.08
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
22.33
Main Chain Side Chain Hydrogen Bonds
6.60
Side Chain Side Chain Hydrogen Bonds
0.78
Hydrophonic Interactions
8.16
Ionic Interactions
1.55
Salt Bridges
0.39
Aromatic Aromatic Interactions
0.39
Aromatic Sulphur Interactions
0.19
Cation Pi Interactions
0.78
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
1.7
PMID
Authors
Bieger, B., Essen, L.-O., Oesterhelt, D.
Journal
Structure
Title
Crystal Structure of Halophilic Dodecin: A Novel, Dodecameric Flavin Binding Protein from Halobacterium salinarum
Volume
11
Year
2003

Information Source

UniProt, RCSB PDB and BRENDA