ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.05.H03
Name
Nucleoside diphosphate kinase
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.05
Name
Halobacterium salinarum
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Protein Classification

EC ID
E2
EC Number
2.7.4.6
Type
TRANSFERASE

Optimum Physiochemical Conditions

Extreme-Stability ID
HA03
Optimum Condition
2.5-5.2M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
18065.0
Sequence Length
(amino acid numbers)
161
Sequence
MTDHDERTFVMVKPDGVQRGLIGDIVTRLETKGLKMVGGKFMRIDEELAHEHYAEHEDKPFFDGLVSFITSGPVFAMVWEGADATRQVRQLMGATDAQDAAPGTIRGDYGNDLGHNLIHGSDHEDEGANEREIALFFDDDELVDWDRDASAWVYEDLADHD

Protein Parameters

PID
H.P0020
Amino acid content (%)
 
Ala
8.696
Cys
0
Asp
14.286
Glu
8.696
Phe
4.969
Gly
9.938
His
4.969
Ile
4.348
Lys
3.106
Leu
6.832
Met
3.727
Asn
1.863
Pro
2.484
Gln
2.484
Arg
5.59
Ser
2.484
Thr
4.969
Val
6.832
Trp
1.863
Tyr
1.863
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
26.09
Small (A+C+D+G+N+P+S+T+V)
51.55
Aliphatic (A+I+L+V)
26.71
Aromatic (F+H+W+Y)
13.67
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
51.55
Polar (D+E+H+K+N+Q+R+S)
48.45
Charged (D+E+H+K+R)
36.65
Basic (H+K+R)
13.67
Acidic (D+E)
22.98
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
5.12
Main Chain Side Chain Hydrogen Bonds
4.78
Side Chain Side Chain Hydrogen Bonds
1.75
Hydrophonic Interactions
2.30
Ionic Interactions
0.96
Salt Bridges
1.33
Aromatic Aromatic Interactions
0.10
Aromatic Sulphur Interactions
0.08
Cation Pi Interactions
0.11
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
2.3
PMID
Authors
Besir, H., Zeth, K., Bracher, A., Heider, U., Ishibashi, M., Tokunaga, M., Oesterhelt, D.
Journal
Febs Lett.
Title
Structure of a halophilic nucleoside diphosphate kinase from Halobacterium salinarum
Volume
579
Year
2005

Information Source

UniProt, RCSB PDB and BRENDA