ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.05.H10
Name
DODECIN
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.05
Name
Halobacterium salinarum
Domain
Archaea
Extremophile Type
Halophile

Protein Function

May function as storage protein that sequesters riboflavin and related compounds, thereby protecting the cell against undesirable reactions mediated by the free flavins. Binds and sequesters riboflavin, lumiflavin and lumichrome. Can also bind FAD and FMN (in vitro), but has low affinity for FAD and even lower affinity for FMN. Protects bound flavins against light damage; Trp-36 rapidly quenches the flavin excited state. Promotes the conversion of bound riboflavin to lumichrome. {ECO

Protein Classification

EC ID
E0
EC Number
-
Type
FLAVOPROTEIN

Optimum Physiochemical Conditions

Extreme-Stability ID
HA03
Optimum Condition
2.5-5.2M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
7438.0
Sequence Length
(amino acid numbers)
68
Sequence
MVFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELDGSQ

Protein Parameters

PID
H.P0003
Amino acid content (%)
 
Ala
11.765
Cys
0
Asp
10.294
Glu
13.235
Phe
4.412
Gly
5.882
His
0
Ile
2.941
Lys
2.941
Leu
5.882
Met
1.471
Asn
1.471
Pro
0
Gln
5.882
Arg
2.941
Ser
4.412
Thr
8.824
Val
14.706
Trp
1.471
Tyr
1.471
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
30.88
Small (A+C+D+G+N+P+S+T+V)
57.35
Aliphatic (A+I+L+V)
35.29
Aromatic (F+H+W+Y)
7.35
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
50.00
Polar (D+E+H+K+N+Q+R+S)
50.00
Charged (D+E+H+K+R)
29.41
Basic (H+K+R)
5.88
Acidic (D+E)
23.53
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
23.35
Main Chain Side Chain Hydrogen Bonds
4.96
Side Chain Side Chain Hydrogen Bonds
0.41
Hydrophonic Interactions
9.09
Ionic Interactions
1.03
Salt Bridges
0.41
Aromatic Aromatic Interactions
0.41
Aromatic Sulphur Interactions
0.21
Cation Pi Interactions
0.83
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
1.6
PMID
Authors
Yu, Y., Heidel, B., Parapugna, T.L., Wenderhold-Reeb, S., Song, B., Schonherr, H., Grininger, M., Noll, G.
Journal
Angew.Chem.Int.Ed.Engl.
Title
The Flavoprotein Dodecin as a Redox Probe for Electron Transfer Through DNA.
Volume
52
Year
2013

Information Source

UniProt, RCSB PDB and BRENDA