ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.01.H02
Name
Catalase-peroxidase 2
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.01
Name
Haloarcula marismortui
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity.

Protein Classification

EC ID
E1
EC Number
1.11.1.21
Type
Oxidoreductase

Optimum Physiochemical Conditions

Extreme-Stability ID
HA04
Optimum Condition
3M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
81384.0
Sequence Length
(amino acid numbers)
731
Sequence
MAETPNSDMSGATGGRSKRPKSNQDWWPSKLNLEILDQNARDVGPVEDDFDYAEEFQKLDLEAVKSDLEELMTSSQDWWPADYGHYGPLFIRMAWHSAGTYRTADGRGGAAGGRQRFAPINSWPDNANLDKARRLLLPIKQKYGQKISWADLMILAGNVAIESMGFKTFGYAGGREDAFEEDKAVNWGPEDEFETQERFDEPGEIQEGLGASVMGLIYVNPEGPDGNPDPEASAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGADDPEENLGPEPEAAPIEQQGLGWQNKNGNSKGGEMITSGIEGPWTQSPTEWDMGYINNLLDYEWEPEKGPGGAWQWAPKSEELKNSVPDAHDPDEKQTPMMLTTDIALKRDPDYREVMETFQENPMEFGMNFAKAWYKLTHRDMGPPERFLGPEVPDEEMIWQDPLPDADYDLIGDEEIAELKEEILDSDLSVSQLVKTAWASASTYRDSDKRGGANGARLRLEPQKNWEVNEPEQLETVLGTLENIQTEFNDSRSDGTQVSLADLIVLGGNAAVEQAAANAGYDVEIPFEPGRVDAGPEHTDAPSFDALKPKVDGVRNYIQDDITRPAEEVLVDNADLLNLTASELTALIGGMRSIGANYQDTDLGVFTDEPETLTNDFFVNLLDMGTEWEPAADSEHRYKGLDRDTGEVKWEATRIDLIFGSNDRLRAISEVYGSADAEKKLVHDFVDTWSKVMKLDRFDLE

Protein Parameters

PID
H.P0016
Amino acid content (%)
 
Ala
8.755
Cys
0
Asp
9.713
Glu
9.986
Phe
3.283
Gly
8.892
His
1.231
Ile
4.104
Lys
4.788
Leu
7.798
Met
2.873
Asn
4.925
Pro
6.156
Gln
3.557
Arg
4.514
Ser
4.925
Thr
4.925
Val
4.241
Trp
2.873
Tyr
2.462
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
27.50
Small (A+C+D+G+N+P+S+T+V)
52.53
Aliphatic (A+I+L+V)
24.90
Aromatic (F+H+W+Y)
9.85
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
51.44
Polar (D+E+H+K+N+Q+R+S)
48.56
Charged (D+E+H+K+R)
30.23
Basic (H+K+R)
10.53
Acidic (D+E)
19.70
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
14.49
Main Chain Side Chain Hydrogen Bonds
8.04
Side Chain Side Chain Hydrogen Bonds
2.77
Hydrophonic Interactions
5.28
Ionic Interactions
1.75
Salt Bridges
1.48
Aromatic Aromatic Interactions
0.28
Aromatic Sulphur Interactions
0.11
Cation Pi Interactions
0.42
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
2.3
PMID
Authors
Sato, T., Higuchi, W., Yoshimatsu, K., Fujiwara, T.
Journal
To be Published
Title
Catalatic Implication Guided by Structure, Kinetics and Theoretical Studies on Ser305Thr and Arg409Leu Variants of HmKatG
Volume
NA
Year
NA

Information Source

UniProt, RCSB PDB and BRENDA