ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.07.H01
Name
Protein Vng1086c
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.07
Name
Halobacterium sp.
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Not known

Protein Classification

EC ID
E0
EC Number
-
Type
STRUCTURAL GENOMICS, UNKNOWN FUNCTION

Optimum Physiochemical Conditions

Extreme-Stability ID
HA03
Optimum Condition
2.5-5.2M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
10381.0
Sequence Length
(amino acid numbers)
92
Sequence
MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDASNQL

Protein Parameters

PID
H.P0032
Amino acid content (%)
 
Ala
11.957
Cys
0
Asp
8.696
Glu
13.043
Phe
5.435
Gly
3.261
His
7.609
Ile
2.174
Lys
6.522
Leu
10.87
Met
4.348
Asn
3.261
Pro
1.087
Gln
3.261
Arg
2.174
Ser
8.696
Thr
1.087
Val
5.435
Trp
0
Tyr
1.087
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
25.00
Small (A+C+D+G+N+P+S+T+V)
43.48
Aliphatic (A+I+L+V)
30.44
Aromatic (F+H+W+Y)
14.13
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
45.65
Polar (D+E+H+K+N+Q+R+S)
54.35
Charged (D+E+H+K+R)
38.04
Basic (H+K+R)
16.30
Acidic (D+E)
21.74
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
18.24
Main Chain Side Chain Hydrogen Bonds
3.55
Side Chain Side Chain Hydrogen Bonds
2.99
Hydrophonic Interactions
2.82
Ionic Interactions
2.42
Salt Bridges
1.29
Aromatic Aromatic Interactions
0.32
Aromatic Sulphur Interactions
0.08
Cation Pi Interactions
0.16
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
2
PMID
Authors
Benach, J., Zhou, W., Jayaraman, S., Forouhar, F.F., Janjua, H., Xiao, R., Ma, L.-C., Cunningham, K., Wang, D., Acton, T.B., Montelione, G.T., Tong, L., Hunt, J.F.
Journal
To be Published
Title
Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
Volume
NA
Year
NA

Information Source

UniProt, RCSB PDB and BRENDA