ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.08.H01
Name
Uncharacterized protein
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.08
Name
Halobacterium sp. NRC-1
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Not known

Protein Classification

EC ID
E0
EC Number
-
Type
Structural Genomics, Unknown Function

Optimum Physiochemical Conditions

Extreme-Stability ID
HA03
Optimum Condition
2.5-5.2M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
20490.0
Sequence Length
(amino acid numbers)
189
Sequence
MSPIPLPVTDTDDAWRARIAAHRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLFVPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDAD

Protein Parameters

PID
H.P0033
Amino acid content (%)
 
Ala
14.815
Cys
1.058
Asp
12.698
Glu
5.82
Phe
5.82
Gly
7.407
His
3.175
Ile
2.646
Lys
0.529
Leu
6.349
Met
0.529
Asn
1.587
Pro
8.466
Gln
1.058
Arg
7.407
Ser
4.233
Thr
6.878
Val
5.291
Trp
0.529
Tyr
3.704
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
34.39
Small (A+C+D+G+N+P+S+T+V)
62.43
Aliphatic (A+I+L+V)
29.10
Aromatic (F+H+W+Y)
13.23
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
56.61
Polar (D+E+H+K+N+Q+R+S)
43.39
Charged (D+E+H+K+R)
29.63
Basic (H+K+R)
11.11
Acidic (D+E)
18.52
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
1.17
Main Chain Side Chain Hydrogen Bonds
22.92
Side Chain Side Chain Hydrogen Bonds
13.50
Hydrophonic Interactions
1.23
Ionic Interactions
0.36
Salt Bridges
9.12
Aromatic Aromatic Interactions
0.11
Aromatic Sulphur Interactions
0.00
Cation Pi Interactions
0.09
Disulphide Bridge Interactions
0.29

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
NA
PMID
Authors
Lange, O.F., Rossi, P., Sgourakis, N.G., Song, Y., Lee, H.W., Aramini, J.M., Ertekin, A., Xiao, R., Acton, T.B., Montelione, G.T., Baker, D.
Journal
Proc.Natl.Acad.Sci.USA
Title
Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
Volume
109
Year
2012

Information Source

UniProt, RCSB PDB and BRENDA