ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.01.H04
Name
Uncharacterized protein
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.01
Name
Haloarcula marismortui
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Not known

Protein Classification

EC ID
E0
EC Number
-
Type
Structural Genomics, Unknown Function

Optimum Physiochemical Conditions

Extreme-Stability ID
HA04
Optimum Condition
3M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
20999.0
Sequence Length
(amino acid numbers)
182
Sequence
MDEDTEDWETQLQANRDEKDRFFSEHRQSPIPPEERDDFDGLSYFDPDPDYRVEATVTVHETPESVDLETSDDRTVRYLHVATLSFDLDGESRDLHAFRQAADESRTLFVPFRDKTTGQQSYDGGRYMELEPDRDLSDGDEITLDFNLAYSPFCAYSDTFSCPLPPESNWLETAVTAGERTD

Protein Parameters

PID
H.P0026
Amino acid content (%)
 
Ala
5.495
Cys
1.099
Asp
14.835
Glu
10.44
Phe
6.044
Gly
3.846
His
2.198
Ile
1.099
Lys
1.099
Leu
7.692
Met
1.099
Asn
1.648
Pro
6.593
Gln
3.297
Arg
7.692
Ser
7.692
Thr
8.791
Val
4.396
Trp
1.099
Tyr
3.846
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
26.92
Small (A+C+D+G+N+P+S+T+V)
54.40
Aliphatic (A+I+L+V)
18.68
Aromatic (F+H+W+Y)
13.19
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
42.31
Polar (D+E+H+K+N+Q+R+S)
57.69
Charged (D+E+H+K+R)
36.26
Basic (H+K+R)
10.99
Acidic (D+E)
25.28
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
1.11
Main Chain Side Chain Hydrogen Bonds
27.12
Side Chain Side Chain Hydrogen Bonds
15.29
Hydrophonic Interactions
0.92
Ionic Interactions
0.35
Salt Bridges
12.61
Aromatic Aromatic Interactions
0.12
Aromatic Sulphur Interactions
0.01
Cation Pi Interactions
0.06
Disulphide Bridge Interactions
0.30

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
NA
PMID
Authors
Lange, O.F., Rossi, P., Sgourakis, N.G., Song, Y., Lee, H.W., Aramini, J.M., Ertekin, A., Xiao, R., Acton, T.B., Montelione, G.T., Baker, D.
Journal
Proc.Natl.Acad.Sci.USA
Title
Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
Volume
109
Year
2012

Information Source

UniProt, RCSB PDB and BRENDA