ExProt DB
Extremophile Protein Database
ExProt DB

   Advanced Search  

 
 

Protein Information

 

Protein Details

ExProtDB ID
A.0000H0.02.H01
Name
PhiH1 repressor-like protein
Extreme Stable Behaviour
Halostable

Source Organism

ExProtDB ID
A.0000H0.02
Name
Haloarcula marismortui ATCC 43049
Domain
Archaea
Extremophile Type
Halophile

Protein Function

Not known

Protein Classification

EC ID
E0
EC Number
-
Type
STRUCTURAL GENOMICS, UNKNOWN FUNCTION

Optimum Physiochemical Conditions

Extreme-Stability ID
HA04
Optimum Condition
3M NaCl

Protein Sequence

UniProt KB ID
Molecular Weight (Da)
12105.0
Sequence Length
(amino acid numbers)
108
Sequence
MRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYINRGNSTDEENGADAPDGPGINS

Protein Parameters

PID
H.P0024
Amino acid content (%)
 
Ala
5.556
Cys
0
Asp
9.259
Glu
12.037
Phe
0
Gly
10.185
His
1.852
Ile
8.333
Lys
4.63
Leu
7.407
Met
1.852
Asn
6.481
Pro
3.704
Gln
1.852
Arg
7.407
Ser
8.333
Thr
2.778
Val
2.778
Trp
1.852
Tyr
3.704
Amino acid class contents(%)
 
Tiny (A+C+G+S+T)
26.85
Small (A+C+D+G+N+P+S+T+V)
49.07
Aliphatic (A+I+L+V)
24.07
Aromatic (F+H+W+Y)
7.41
Non Polar (A+C+F+G+I+L+M+P+V+W+Y)
45.37
Polar (D+E+H+K+N+Q+R+S)
54.63
Charged (D+E+H+K+R)
35.19
Basic (H+K+R)
13.89
Acidic (D+E)
21.30
Intraprotein interactions (%)
 
Main Chain Main Chain Hydrogen Bonds
13.01
Main Chain Side Chain Hydrogen Bonds
5.62
Side Chain Side Chain Hydrogen Bonds
4.04
Hydrophonic Interactions
4.45
Ionic Interactions
2.40
Salt Bridges
2.60
Aromatic Aromatic Interactions
0.07
Aromatic Sulphur Interactions
0.07
Cation Pi Interactions
0.41
Disulphide Bridge Interactions
0.00

Protein Structure Details

RCSB PDB ID
Structure Resolution (A)
2.1
PMID
Authors
Kim, Y., Zhou, M., Keigher, L., Joachimiak, A.
Journal
To be Published
Title
Crystal Structure of the PhiH1 repressor-like Protein from Haloarcula marismortui.
Volume
NA
Year
NA

Information Source

UniProt, RCSB PDB and BRENDA